PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN39649.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YA
Protein Properties Length: 319aa    MW: 35338.9 Da    PI: 9.0604
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN39649.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.86.6e-32183238258
   CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  p+YVNaKQy++Il+RRq Rakle+++kl +k+rkpylheSRh hAl+R+RgsgGrF
  KHN39649.1 183 GPMYVNAKQYHAILRRRQYRAKLEAQNKL-IKERKPYLHESRHLHALKRARGSGGRF 238
                 69***************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.4E-36180241IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.98181241IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.1E-24184206IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.3E-26184238IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860186206IPR018362CCAAT-binding factor, conserved site
PRINTSPR006168.1E-24215238IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MKNLCEKDSG PTHLTYYALG RTSWGTSSES DVQQSSMSKS LSLKISVLPQ QCHKTKLLNF  60
QYQDRDSSST QSSGQSYPEV GSAQSGQISV QCSNCSACST LNTTGGKSVE GVISSTVGIQ  120
DYTFPLSQLC YNQSLAHTAF HFAEPCFIGL VAAPYAPQPN INDAQLVGMS PARIPLPPDL  180
IEGPMYVNAK QYHAILRRRQ YRAKLEAQNK LIKERKPYLH ESRHLHALKR ARGSGGRFLN  240
AKKLTSANHG DSITTCSDVF QQHESDFRLC GYPSRIGRSV QGYSVEINII YQSLCDKLFW  300
HTSKCSIGKS SLAHLHYYV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A8e-23181251171NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ7755280.0FJ775528.1 Glycine max CCAAT-binding transcription factor family protein (NF-YA1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006598809.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
TrEMBLA0A0B2S5T50.0A0A0B2S5T5_GLYSO; Nuclear transcription factor Y subunit A-3
TrEMBLK7MEE60.0K7MEE6_SOYBN; Uncharacterized protein
STRINGGLYMA16G00711.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101202541
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.13e-46nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]